PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0034100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 345aa    MW: 35445.2 Da    PI: 6.779
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0034100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.6e-091451148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++lvd+++  G g          + R++k+c++rw +yl
   Spipo1G0034100 14 KGPWSPEEDKILVDYIQANGLG----------LLRCGKSCRLRWTNYL 51
                     79******************88..........789***********97 PP

2Myb_DNA-binding52.31.3e-1657102148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +v+++   G++ W+tIa+ ++ gRt++++k++w+++l
   Spipo1G0034100  57 RGPFTPEEQKSIVQLHGIVGNK-WSTIAAQLP-GRTDNEIKNYWNTHL 102
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.754951IPR017930Myb domain
SuperFamilySSF466897.11E-251198IPR009057Homeodomain-like
SMARTSM007172.7E-51353IPR001005SANT/Myb domain
PfamPF002495.5E-71451IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-151558IPR009057Homeodomain-like
PROSITE profilePS5129425.53852106IPR017930Myb domain
SMARTSM007176.5E-1556104IPR001005SANT/Myb domain
PfamPF002491.0E-1457102IPR001005SANT/Myb domain
CDDcd001671.31E-1059102No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2759107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRAPCCDKQ GLRKGPWSPE EDKILVDYIQ ANGLGLLRCG KSCRLRWTNY LRPDIKRGPF  60
TPEEQKSIVQ LHGIVGNKWS TIAAQLPGRT DNEIKNYWNT HLKKRLVLMG INPETYAPSS  120
GATSLSSTGT GGGGSAPPPP SGGPAAASSS STRHMAQWES ARLEAEARLS RESLLFSASG  180
GGGAASSALS NHSPAAKTDT DFFLRMWNSE VGEAFRGKET APAAGASPAS SSTKCGGGAA  240
PRLVKKGSRG GSGGGATSVS SGEPKEDGDC KSSVSGGGAG GAANADSSSS NEMEDTSEET  300
YQMYLNLVGD DMALGHLFHG GLDSISLFGG DPNAAEASLD LAFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25121065108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086212e-60AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
GenBankBT0660052e-60BT066005.1 Zea mays full-length cDNA clone ZM_BFb0144N05 mRNA, complete cds.
GenBankEU9596112e-60EU959611.1 Zea mays clone 218856 P-type R2R3 Myb protein mRNA, complete cds.
GenBankKJ7269002e-60KJ726900.1 Zea mays clone pUT3445 MYB transcription factor (MYB89) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008794546.11e-118PREDICTED: myb-related protein Myb4-like isoform X2
TrEMBLA0A061E1591e-103A0A061E159_THECC; Myb domain protein 17 isoform 1
STRINGVIT_15s0046g03190.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.16e-79myb domain protein 17